PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr4P31020_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family BES1
Protein Properties Length: 259aa    MW: 28051 Da    PI: 6.5077
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr4P31020_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822208.51.8e-6421491148
                 DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl.eeaeaagssas 87 
                            ++++r+ptw+ErEnn+rRERrRRa+aakiy+GLR++Gnyklpk++DnneVlkALc eAGw ve+DGttyrkg+kp+ e+++++g s+s
  GSMUA_Achr4P31020_001   2 TSGTRMPTWRERENNRRRERRRRAVAAKIYTGLRMYGNYKLPKHCDNNEVLKALCDEAGWSVEPDGTTYRKGCKPPaEHMDIVGGSNS 89 
                            5899************************************************************************************ PP

                 DUF822  88 aspesslqsslkssalaspvesysaspksssfpspssldsislasaasllpvlsvlslvss 148
                             sp ss q s+ +s+ +sp++s+ asp+sss+   ++ +si++a+a+sl+p+l++ls++s 
  GSMUA_Achr4P31020_001  90 HSPYSSNQPSPCTSYNPSPASSSYASPASSSYIVATN-NSINAADANSLIPWLKNLSSAST 149
                            ******9977777777777777777777777776666.44555667*********998554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.9E-683145IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MTSGTRMPTW RERENNRRRE RRRRAVAAKI YTGLRMYGNY KLPKHCDNNE VLKALCDEAG  60
WSVEPDGTTY RKGCKPPAEH MDIVGGSNSH SPYSSNQPSP CTSYNPSPAS SSYASPASSS  120
YIVATNNSIN AADANSLIPW LKNLSSASTS DLTSSPTAQT PHIKFIPDPA WIAGLQIETV  180
MWTPGQSGTS SPALPGMPHN VGIQMSDGIS QEFAFGSSAT DDNPIATLVK PWEGERIHEE  240
CGSDDLELTL GSSRTRADS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009397454.11e-148PREDICTED: protein BZR1 homolog 2-like
SwissprotQ9ZV882e-81BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLM0STL40.0M0STL4_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P31020_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP136638112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18890.15e-65BES1/BZR1 homolog 3